Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA071119-25
  • Immunohistochemistry analysis in human epididymis and colon tissues using Anti-WFDC8 antibody. Corresponding WFDC8 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WAP four-disulfide core domain 8
Gene Name: WFDC8
Alternative Gene Name: C20orf170, dJ461P17.1, WAP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070533: 73%, ENSRNOG00000014771: 73%
Entrez Gene ID: 90199
Uniprot ID: Q8IUA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR
Gene Sequence GQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR
Gene ID - Mouse ENSMUSG00000070533
Gene ID - Rat ENSRNOG00000014771
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation)
Datasheet Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation)
Datasheet Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation)



Citations for Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) – 1 Found
Leir, Shih-Hsing; Yin, Shiyi; Kerschner, Jenny L; Cosme, Wilmel; Harris, Ann. An atlas of human proximal epididymis reveals cell-specific functions and distinct roles for CFTR. Life Science Alliance. 2020;3(11)  PubMed