Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA071119-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: WFDC8
Alternative Gene Name: C20orf170, dJ461P17.1, WAP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070533: 73%, ENSRNOG00000014771: 73%
Entrez Gene ID: 90199
Uniprot ID: Q8IUA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR |
Gene Sequence | GQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR |
Gene ID - Mouse | ENSMUSG00000070533 |
Gene ID - Rat | ENSRNOG00000014771 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) | |
Datasheet | Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) | |
Datasheet | Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) |
Citations for Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) – 1 Found |
Leir, Shih-Hsing; Yin, Shiyi; Kerschner, Jenny L; Cosme, Wilmel; Harris, Ann. An atlas of human proximal epididymis reveals cell-specific functions and distinct roles for CFTR. Life Science Alliance. 2020;3(11) PubMed |