Anti WEE2 pAb (ATL-HPA054280)

Atlas Antibodies

Catalog No.:
ATL-HPA054280-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WEE1 homolog 2
Gene Name: WEE2
Alternative Gene Name: FLJ16107
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037159: 43%, ENSRNOG00000026446: 41%
Entrez Gene ID: 494551
Uniprot ID: P0C1S8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPLSNVHELDTSSEKDKESPDQILRTPVSHPLKC
Gene Sequence DIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPLSNVHELDTSSEKDKESPDQILRTPVSHPLKC
Gene ID - Mouse ENSMUSG00000037159
Gene ID - Rat ENSRNOG00000026446
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WEE2 pAb (ATL-HPA054280)
Datasheet Anti WEE2 pAb (ATL-HPA054280) Datasheet (External Link)
Vendor Page Anti WEE2 pAb (ATL-HPA054280) at Atlas Antibodies

Documents & Links for Anti WEE2 pAb (ATL-HPA054280)
Datasheet Anti WEE2 pAb (ATL-HPA054280) Datasheet (External Link)
Vendor Page Anti WEE2 pAb (ATL-HPA054280)