Anti WEE1 pAb (ATL-HPA068845)

Atlas Antibodies

SKU:
ATL-HPA068845-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoli.
  • Western blot analysis in human cell line BEWO.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: WEE1 G2 checkpoint kinase
Gene Name: WEE1
Alternative Gene Name: WEE1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031016: 95%, ENSRNOG00000010017: 95%
Entrez Gene ID: 7465
Uniprot ID: P30291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQ
Gene Sequence LLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQ
Gene ID - Mouse ENSMUSG00000031016
Gene ID - Rat ENSRNOG00000010017
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WEE1 pAb (ATL-HPA068845)
Datasheet Anti WEE1 pAb (ATL-HPA068845) Datasheet (External Link)
Vendor Page Anti WEE1 pAb (ATL-HPA068845) at Atlas Antibodies

Documents & Links for Anti WEE1 pAb (ATL-HPA068845)
Datasheet Anti WEE1 pAb (ATL-HPA068845) Datasheet (External Link)
Vendor Page Anti WEE1 pAb (ATL-HPA068845)