Anti WDYHV1 pAb (ATL-HPA053680)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053680-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: WDYHV1
Alternative Gene Name: C8orf32, FLJ10204
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022359: 82%, ENSRNOG00000006700: 84%
Entrez Gene ID: 55093
Uniprot ID: Q96HA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDDDIHPQFRRKFRVIRADS |
| Gene Sequence | RPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDDDIHPQFRRKFRVIRADS |
| Gene ID - Mouse | ENSMUSG00000022359 |
| Gene ID - Rat | ENSRNOG00000006700 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WDYHV1 pAb (ATL-HPA053680) | |
| Datasheet | Anti WDYHV1 pAb (ATL-HPA053680) Datasheet (External Link) |
| Vendor Page | Anti WDYHV1 pAb (ATL-HPA053680) at Atlas Antibodies |
| Documents & Links for Anti WDYHV1 pAb (ATL-HPA053680) | |
| Datasheet | Anti WDYHV1 pAb (ATL-HPA053680) Datasheet (External Link) |
| Vendor Page | Anti WDYHV1 pAb (ATL-HPA053680) |