Anti WDYHV1 pAb (ATL-HPA053680)

Atlas Antibodies

Catalog No.:
ATL-HPA053680-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WDYHV motif containing 1
Gene Name: WDYHV1
Alternative Gene Name: C8orf32, FLJ10204
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022359: 82%, ENSRNOG00000006700: 84%
Entrez Gene ID: 55093
Uniprot ID: Q96HA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDDDIHPQFRRKFRVIRADS
Gene Sequence RPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDDDIHPQFRRKFRVIRADS
Gene ID - Mouse ENSMUSG00000022359
Gene ID - Rat ENSRNOG00000006700
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDYHV1 pAb (ATL-HPA053680)
Datasheet Anti WDYHV1 pAb (ATL-HPA053680) Datasheet (External Link)
Vendor Page Anti WDYHV1 pAb (ATL-HPA053680) at Atlas Antibodies

Documents & Links for Anti WDYHV1 pAb (ATL-HPA053680)
Datasheet Anti WDYHV1 pAb (ATL-HPA053680) Datasheet (External Link)
Vendor Page Anti WDYHV1 pAb (ATL-HPA053680)