Anti WDTC1 pAb (ATL-HPA028180)

Atlas Antibodies

Catalog No.: ATL-HPA028180-100

Protein Description: WD and tetratricopeptide repeats 1
Gene Name: WDTC1
Alternative Gene Name: ADP, DCAF9, KIAA1037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037622: 95%, ENSRNOG00000008377: 95%
Entrez Gene ID: 23038
Uniprot ID: Q8N5D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLVATYVTFSPNGTELLVNMGGEQVYLFDLTYKQRPYTFLLPRKCHSSGEVQNGKMSTNGVSNGVSNGLHLHSNGFRLPESRGHVSPQVELPPYLERVKQQANE
• Gene Sequence: VLVATYVTFSPNGTELLVNMGGEQVYLFDLTYKQRPYTFLLPRKCHSSGEVQNGKMSTNGVSNGVSNGLHLHSNGFRLPESRGHVSPQVELPPYLERVKQQANE
• Gene ID - Mouse: ENSMUSG00000037622
• Gene ID - Rat: ENSRNOG00000008377
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.