Anti WDR89 pAb (ATL-HPA000813)

Atlas Antibodies

Catalog No.:
ATL-HPA000813-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 89
Gene Name: WDR89
Alternative Gene Name: C14orf150, MGC9907
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045690: 80%, ENSRNOG00000021628: 79%
Entrez Gene ID: 112840
Uniprot ID: Q96FK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEGFYWWDLNHLDTDEPVTRLNIQDVREVVNMKEDALDYLIGGLYHEKTDTLHVIGGTNKGRIHLMNCSMSGLTHVTSLQGGHAATVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQRVRVHSN
Gene Sequence DEGFYWWDLNHLDTDEPVTRLNIQDVREVVNMKEDALDYLIGGLYHEKTDTLHVIGGTNKGRIHLMNCSMSGLTHVTSLQGGHAATVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQRVRVHSN
Gene ID - Mouse ENSMUSG00000045690
Gene ID - Rat ENSRNOG00000021628
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR89 pAb (ATL-HPA000813)
Datasheet Anti WDR89 pAb (ATL-HPA000813) Datasheet (External Link)
Vendor Page Anti WDR89 pAb (ATL-HPA000813) at Atlas Antibodies

Documents & Links for Anti WDR89 pAb (ATL-HPA000813)
Datasheet Anti WDR89 pAb (ATL-HPA000813) Datasheet (External Link)
Vendor Page Anti WDR89 pAb (ATL-HPA000813)