Anti WDR88 pAb (ATL-HPA050336)

Atlas Antibodies

Catalog No.:
ATL-HPA050336-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 88
Gene Name: WDR88
Alternative Gene Name: PQWD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037296: 24%, ENSRNOG00000037393: 55%
Entrez Gene ID: 126248
Uniprot ID: Q6ZMY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILSASKDRTMRLWNIEEIDEIPLVIKYKKAVGLKLKQCERCDRPFSIFKSDTSSEMFTQCVFCRIDTRGLPADTS
Gene Sequence ILSASKDRTMRLWNIEEIDEIPLVIKYKKAVGLKLKQCERCDRPFSIFKSDTSSEMFTQCVFCRIDTRGLPADTS
Gene ID - Mouse ENSMUSG00000037296
Gene ID - Rat ENSRNOG00000037393
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR88 pAb (ATL-HPA050336)
Datasheet Anti WDR88 pAb (ATL-HPA050336) Datasheet (External Link)
Vendor Page Anti WDR88 pAb (ATL-HPA050336) at Atlas Antibodies

Documents & Links for Anti WDR88 pAb (ATL-HPA050336)
Datasheet Anti WDR88 pAb (ATL-HPA050336) Datasheet (External Link)
Vendor Page Anti WDR88 pAb (ATL-HPA050336)