Anti WDR72 pAb (ATL-HPA057410)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057410-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: WDR72
Alternative Gene Name: FLJ38736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044976: 84%, ENSRNOG00000054889: 84%
Entrez Gene ID: 256764
Uniprot ID: Q3MJ13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GHSYIYQLLNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYF |
Gene Sequence | GHSYIYQLLNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYF |
Gene ID - Mouse | ENSMUSG00000044976 |
Gene ID - Rat | ENSRNOG00000054889 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti WDR72 pAb (ATL-HPA057410) | |
Datasheet | Anti WDR72 pAb (ATL-HPA057410) Datasheet (External Link) |
Vendor Page | Anti WDR72 pAb (ATL-HPA057410) at Atlas Antibodies |
Documents & Links for Anti WDR72 pAb (ATL-HPA057410) | |
Datasheet | Anti WDR72 pAb (ATL-HPA057410) Datasheet (External Link) |
Vendor Page | Anti WDR72 pAb (ATL-HPA057410) |
Citations for Anti WDR72 pAb (ATL-HPA057410) – 2 Found |
Husein, Dina; Alamoudi, Ahmed; Ohyama, Yoshio; Mochida, Hanna; Ritter, Brigitte; Mochida, Yoshiyuki. Identification of the C-terminal region in Amelogenesis Imperfecta causative protein WDR72 required for Golgi localization. Scientific Reports. 2022;12(1):4640. PubMed |
Joseph, Christina B; Mariniello, Marta; Yoshifuji, Ayumi; Schiano, Guglielmo; Lake, Jennifer; Marten, Jonathan; Richmond, Anne; Huffman, Jennifer E; Campbell, Archie; Harris, Sarah E; Troyanov, Stephan; Cocca, Massimiliano; Robino, Antonietta; Thériault, Sébastien; Eckardt, Kai-Uwe; Wuttke, Matthias; Cheng, Yurong; Corre, Tanguy; Kolcic, Ivana; Black, Corrinda; Bruat, Vanessa; Concas, Maria Pina; Sala, Cinzia; Aeschbacher, Stefanie; Schaefer, Franz; Bergmann, Sven; Campbell, Harry; Olden, Matthias; Polasek, Ozren; Porteous, David J; Deary, Ian J; Madore, Francois; Awadalla, Philip; Girotto, Giorgia; Ulivi, Sheila; Conen, David; Wuehl, Elke; Olinger, Eric; Wilson, James F; Bochud, Murielle; Köttgen, Anna; Hayward, Caroline; Devuyst, Olivier. Meta-GWAS Reveals Novel Genetic Variants Associated with Urinary Excretion of Uromodulin. Journal Of The American Society Of Nephrology : Jasn. 2022;33(3):511-529. PubMed |