Anti WDR72 pAb (ATL-HPA057410)

Atlas Antibodies

Catalog No.:
ATL-HPA057410-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 72
Gene Name: WDR72
Alternative Gene Name: FLJ38736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044976: 84%, ENSRNOG00000054889: 84%
Entrez Gene ID: 256764
Uniprot ID: Q3MJ13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHSYIYQLLNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYF
Gene Sequence GHSYIYQLLNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYF
Gene ID - Mouse ENSMUSG00000044976
Gene ID - Rat ENSRNOG00000054889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR72 pAb (ATL-HPA057410)
Datasheet Anti WDR72 pAb (ATL-HPA057410) Datasheet (External Link)
Vendor Page Anti WDR72 pAb (ATL-HPA057410) at Atlas Antibodies

Documents & Links for Anti WDR72 pAb (ATL-HPA057410)
Datasheet Anti WDR72 pAb (ATL-HPA057410) Datasheet (External Link)
Vendor Page Anti WDR72 pAb (ATL-HPA057410)
Citations for Anti WDR72 pAb (ATL-HPA057410) – 2 Found
Husein, Dina; Alamoudi, Ahmed; Ohyama, Yoshio; Mochida, Hanna; Ritter, Brigitte; Mochida, Yoshiyuki. Identification of the C-terminal region in Amelogenesis Imperfecta causative protein WDR72 required for Golgi localization. Scientific Reports. 2022;12(1):4640.  PubMed
Joseph, Christina B; Mariniello, Marta; Yoshifuji, Ayumi; Schiano, Guglielmo; Lake, Jennifer; Marten, Jonathan; Richmond, Anne; Huffman, Jennifer E; Campbell, Archie; Harris, Sarah E; Troyanov, Stephan; Cocca, Massimiliano; Robino, Antonietta; Thériault, Sébastien; Eckardt, Kai-Uwe; Wuttke, Matthias; Cheng, Yurong; Corre, Tanguy; Kolcic, Ivana; Black, Corrinda; Bruat, Vanessa; Concas, Maria Pina; Sala, Cinzia; Aeschbacher, Stefanie; Schaefer, Franz; Bergmann, Sven; Campbell, Harry; Olden, Matthias; Polasek, Ozren; Porteous, David J; Deary, Ian J; Madore, Francois; Awadalla, Philip; Girotto, Giorgia; Ulivi, Sheila; Conen, David; Wuehl, Elke; Olinger, Eric; Wilson, James F; Bochud, Murielle; Köttgen, Anna; Hayward, Caroline; Devuyst, Olivier. Meta-GWAS Reveals Novel Genetic Variants Associated with Urinary Excretion of Uromodulin. Journal Of The American Society Of Nephrology : Jasn. 2022;33(3):511-529.  PubMed