Anti WDR7 pAb (ATL-HPA042074)

Atlas Antibodies

Catalog No.: ATL-HPA042074-25

Protein Description: WD repeat domain 7
Gene Name: WDR7
Alternative Gene Name: KIAA0541, TRAG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040560: 98%, ENSRNOG00000018387: 99%
Entrez Gene ID: 23335
Uniprot ID: Q9Y4E6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKVQEEEHDLVDDDITTGCLSSVPQMKKISTSYEERRKQATAIVLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHS
• Gene Sequence: AKVQEEEHDLVDDDITTGCLSSVPQMKKISTSYEERRKQATAIVLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHS
• Gene ID - Mouse: ENSMUSG00000040560
• Gene ID - Rat: ENSRNOG00000018387
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WDR7 pAb (ATL-HPA042074) – 1 Found

Crummy, Ellen; Mani, Muralidharan; Thellman, John C; Martin, Thomas F J. The priming factor CAPS1 regulates dense-core vesicle acidification by interacting with rabconnectin3β/WDR7 in neuroendocrine cells. The Journal Of Biological Chemistry. 2019;294(24):9402-9415.