Anti WDR60 pAb (ATL-HPA020607)

Atlas Antibodies

Catalog No.:
ATL-HPA020607-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 60
Gene Name: WDR60
Alternative Gene Name: FAP163, FLJ10300
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042050: 82%, ENSRNOG00000004520: 82%
Entrez Gene ID: 55112
Uniprot ID: Q8WVS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVH
Gene Sequence DIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVH
Gene ID - Mouse ENSMUSG00000042050
Gene ID - Rat ENSRNOG00000004520
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR60 pAb (ATL-HPA020607)
Datasheet Anti WDR60 pAb (ATL-HPA020607) Datasheet (External Link)
Vendor Page Anti WDR60 pAb (ATL-HPA020607) at Atlas Antibodies

Documents & Links for Anti WDR60 pAb (ATL-HPA020607)
Datasheet Anti WDR60 pAb (ATL-HPA020607) Datasheet (External Link)
Vendor Page Anti WDR60 pAb (ATL-HPA020607)
Citations for Anti WDR60 pAb (ATL-HPA020607) – 2 Found
Asante, David; Stevenson, Nicola L; Stephens, David J. Subunit composition of the human cytoplasmic dynein-2 complex. Journal Of Cell Science. 2014;127(Pt 21):4774-87.  PubMed
Li, Cui; Zheng, Yu; Zheng, Yufang; Xu, Zhiheng. SRPS associated protein WDR60 regulates the multipolar-to-bipolar transition of migrating neurons during cortical development. Cell Death & Disease. 2021;12(1):75.  PubMed