Anti WDR5 pAb (ATL-HPA047182)

Atlas Antibodies

Catalog No.:
ATL-HPA047182-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 5
Gene Name: WDR5
Alternative Gene Name: CFAP89, SWD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026917: 100%, ENSRNOG00000008212: 100%
Entrez Gene ID: 11091
Uniprot ID: P61964
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSS
Gene Sequence ATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSS
Gene ID - Mouse ENSMUSG00000026917
Gene ID - Rat ENSRNOG00000008212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR5 pAb (ATL-HPA047182)
Datasheet Anti WDR5 pAb (ATL-HPA047182) Datasheet (External Link)
Vendor Page Anti WDR5 pAb (ATL-HPA047182) at Atlas Antibodies

Documents & Links for Anti WDR5 pAb (ATL-HPA047182)
Datasheet Anti WDR5 pAb (ATL-HPA047182) Datasheet (External Link)
Vendor Page Anti WDR5 pAb (ATL-HPA047182)