Anti WDR31 pAb (ATL-HPA019340)

Atlas Antibodies

Catalog No.:
ATL-HPA019340-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 31
Gene Name: WDR31
Alternative Gene Name: FLJ35921
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028391: 74%, ENSRNOG00000014869: 75%
Entrez Gene ID: 114987
Uniprot ID: Q8NA23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLLLRCQLKQAPPQKVSFRFCVVMGKQQSKLKHSTYKYGRPDEIIEERIQTKAFQEYSPAHMDTVSVVAALNSDLCVSGGKDKT
Gene Sequence MLLLRCQLKQAPPQKVSFRFCVVMGKQQSKLKHSTYKYGRPDEIIEERIQTKAFQEYSPAHMDTVSVVAALNSDLCVSGGKDKT
Gene ID - Mouse ENSMUSG00000028391
Gene ID - Rat ENSRNOG00000014869
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR31 pAb (ATL-HPA019340)
Datasheet Anti WDR31 pAb (ATL-HPA019340) Datasheet (External Link)
Vendor Page Anti WDR31 pAb (ATL-HPA019340) at Atlas Antibodies

Documents & Links for Anti WDR31 pAb (ATL-HPA019340)
Datasheet Anti WDR31 pAb (ATL-HPA019340) Datasheet (External Link)
Vendor Page Anti WDR31 pAb (ATL-HPA019340)