Anti WDR26 pAb (ATL-HPA061094)

Atlas Antibodies

SKU:
ATL-HPA061094-100
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & cytosol.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 26
Gene Name: WDR26
Alternative Gene Name: FLJ21016, GID7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038733: 99%, ENSRNOG00000003723: 100%
Entrez Gene ID: 80232
Uniprot ID: Q9H7D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVQCLWCLSDGKTVLASDTHQRIRGYNFEDLTDRNIVQEDHPIMSFTISKNGRLALLNVATQGVHLWDLQDRVLVRKYQGVTQGFYTIHSCFGGHNEDFIASGS
Gene Sequence RVQCLWCLSDGKTVLASDTHQRIRGYNFEDLTDRNIVQEDHPIMSFTISKNGRLALLNVATQGVHLWDLQDRVLVRKYQGVTQGFYTIHSCFGGHNEDFIASGS
Gene ID - Mouse ENSMUSG00000038733
Gene ID - Rat ENSRNOG00000003723
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WDR26 pAb (ATL-HPA061094)
Datasheet Anti WDR26 pAb (ATL-HPA061094) Datasheet (External Link)
Vendor Page Anti WDR26 pAb (ATL-HPA061094) at Atlas Antibodies

Documents & Links for Anti WDR26 pAb (ATL-HPA061094)
Datasheet Anti WDR26 pAb (ATL-HPA061094) Datasheet (External Link)
Vendor Page Anti WDR26 pAb (ATL-HPA061094)