Anti WDR18 pAb (ATL-HPA050193 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050193-100

• 
• 
• 

Protein Description: WD repeat domain 18
Gene Name: WDR18
Alternative Gene Name: Ipi3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035754: 75%, ENSRNOG00000012379: 74%
Entrez Gene ID: 57418
Uniprot ID: Q9BV38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPHFNKHLLGAEHGDEPRHGGLTLRLGLHQQGSEPSYLDRTEQLQAVLCSTMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFST
• Gene Sequence: LPHFNKHLLGAEHGDEPRHGGLTLRLGLHQQGSEPSYLDRTEQLQAVLCSTMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFST
• Gene ID - Mouse: ENSMUSG00000035754
• Gene ID - Rat: ENSRNOG00000012379
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.