Anti WDR17 pAb (ATL-HPA042766)

Atlas Antibodies

Catalog No.:
ATL-HPA042766-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 17
Gene Name: WDR17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039375: 84%, ENSRNOG00000048847: 65%
Entrez Gene ID: 116966
Uniprot ID: Q8IZU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDVVAFVSHRGPLFIWTISGPDSGVIVHKDAHSFLSDICMFRWHTHQKGKVVFGHIDGSLSIFHPGNKNQKHVLRPESLEGTDEEDPVTALEWDPLST
Gene Sequence EDVVAFVSHRGPLFIWTISGPDSGVIVHKDAHSFLSDICMFRWHTHQKGKVVFGHIDGSLSIFHPGNKNQKHVLRPESLEGTDEEDPVTALEWDPLST
Gene ID - Mouse ENSMUSG00000039375
Gene ID - Rat ENSRNOG00000048847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR17 pAb (ATL-HPA042766)
Datasheet Anti WDR17 pAb (ATL-HPA042766) Datasheet (External Link)
Vendor Page Anti WDR17 pAb (ATL-HPA042766) at Atlas Antibodies

Documents & Links for Anti WDR17 pAb (ATL-HPA042766)
Datasheet Anti WDR17 pAb (ATL-HPA042766) Datasheet (External Link)
Vendor Page Anti WDR17 pAb (ATL-HPA042766)