Anti WDR13 pAb (ATL-HPA000913 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000913-25

Protein Description: WD repeat domain 13
Gene Name: WDR13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031166: 98%, ENSRNOG00000039587: 98%
Entrez Gene ID: 64743
Uniprot ID: Q9H1Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVPAPPTVLRVLR
• Gene Sequence: GHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVPAPPTVLRVLR
• Gene ID - Mouse: ENSMUSG00000031166
• Gene ID - Rat: ENSRNOG00000039587
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WDR13 pAb (ATL-HPA000913 w/enhanced validation) – 6 Found

Singh, Vijay Pratap; Alex, Jomini Liza; Lakshmi, B Jyothi; Sailasree, S Purnima; Raj, T Avinash; Kumar, Satish. Role of mouse Wdr13 in placental growth; a genetic evidence for lifetime body weight determination by placenta during development. Scientific Reports. 2015;5( 26306915):13371. 

Mitra, Shiladitya; Sameer Kumar, Ghantasala S; Tiwari, Vivek; Lakshmi, B Jyothi; Thakur, Suman S; Kumar, Satish. Implication of Genetic Deletion of Wdr13 in Mice: Mild Anxiety, Better Performance in Spatial Memory Task, with Upregulation of Multiple Synaptic Proteins. Frontiers In Molecular Neuroscience. 9( 27625594):73. 

Singh, Vijay Pratap; Katta, Saritha; Kumar, Satish. WD-repeat protein WDR13 is a novel transcriptional regulator of c-Jun and modulates intestinal homeostasis in mice. Bmc Cancer. 2017;17(1):148. 

Singh, Vijay Pratap; Lakshmi, B Jyothi; Singh, Shalu; Shah, Vanya; Goel, Sandeep; Sarathi, D Partha; Kumar, Satish. Lack of Wdr13 gene in mice leads to enhanced pancreatic beta cell proliferation, hyperinsulinemia and mild obesity. Plos One. 7(6):e38685. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Singh, Shalu; Pavuluri, Sivapriya; Jyothi Lakshmi, B; Biswa, Bhim B; Venkatachalam, Bharathi; Tripura, Chaturvedula; Kumar, Satish. Molecular characterization of Wdr13 knockout female mice uteri: a model for human endometrial hyperplasia. Scientific Reports. 2020;10(1):14621.