Anti WDR1 pAb (ATL-HPA070293)

Atlas Antibodies

SKU:
ATL-HPA070293-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cell junctions.
  • Western blot analysis in human cell line MOLT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 1
Gene Name: WDR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005103: 90%, ENSRNOG00000028498: 92%
Entrez Gene ID: 9948
Uniprot ID: O75083
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGT
Gene Sequence KLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGT
Gene ID - Mouse ENSMUSG00000005103
Gene ID - Rat ENSRNOG00000028498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WDR1 pAb (ATL-HPA070293)
Datasheet Anti WDR1 pAb (ATL-HPA070293) Datasheet (External Link)
Vendor Page Anti WDR1 pAb (ATL-HPA070293) at Atlas Antibodies

Documents & Links for Anti WDR1 pAb (ATL-HPA070293)
Datasheet Anti WDR1 pAb (ATL-HPA070293) Datasheet (External Link)
Vendor Page Anti WDR1 pAb (ATL-HPA070293)