Anti WDFY2 pAb (ATL-HPA050094)

Atlas Antibodies

Catalog No.:
ATL-HPA050094-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: WD repeat and FYVE domain containing 2
Gene Name: WDFY2
Alternative Gene Name: ZFYVE22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014547: 100%, ENSRNOG00000010042: 98%
Entrez Gene ID: 115825
Uniprot ID: Q96P53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDM
Gene Sequence VCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDM
Gene ID - Mouse ENSMUSG00000014547
Gene ID - Rat ENSRNOG00000010042
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDFY2 pAb (ATL-HPA050094)
Datasheet Anti WDFY2 pAb (ATL-HPA050094) Datasheet (External Link)
Vendor Page Anti WDFY2 pAb (ATL-HPA050094) at Atlas Antibodies

Documents & Links for Anti WDFY2 pAb (ATL-HPA050094)
Datasheet Anti WDFY2 pAb (ATL-HPA050094) Datasheet (External Link)
Vendor Page Anti WDFY2 pAb (ATL-HPA050094)