Anti WDCP pAb (ATL-HPA041054)

Atlas Antibodies

Catalog No.: ATL-HPA041054-25

Protein Description: WD repeat and coiled coil containing
Gene Name: WDCP
Alternative Gene Name: C2orf44, FLJ21945
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051721: 63%, ENSRNOG00000049989: 66%
Entrez Gene ID: 80304
Uniprot ID: Q9H6R7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQIRLENTERPKGICFLTDQLLLILVGKQKLTDTTFLPSSKSDQYAISLIVREIMLEEEPSITSGESQTTYSTFSAPLNK
• Gene Sequence: QQIRLENTERPKGICFLTDQLLLILVGKQKLTDTTFLPSSKSDQYAISLIVREIMLEEEPSITSGESQTTYSTFSAPLNK
• Gene ID - Mouse: ENSMUSG00000051721
• Gene ID - Rat: ENSRNOG00000049989
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.