Anti WBP4 pAb (ATL-HPA058738)

Atlas Antibodies

Catalog No.:
ATL-HPA058738-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WW domain binding protein 4
Gene Name: WBP4
Alternative Gene Name: FBP21, MGC117310
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022023: 66%, ENSRNOG00000011678: 62%
Entrez Gene ID: 11193
Uniprot ID: O75554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIKQ
Gene Sequence SDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIKQ
Gene ID - Mouse ENSMUSG00000022023
Gene ID - Rat ENSRNOG00000011678
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WBP4 pAb (ATL-HPA058738)
Datasheet Anti WBP4 pAb (ATL-HPA058738) Datasheet (External Link)
Vendor Page Anti WBP4 pAb (ATL-HPA058738) at Atlas Antibodies

Documents & Links for Anti WBP4 pAb (ATL-HPA058738)
Datasheet Anti WBP4 pAb (ATL-HPA058738) Datasheet (External Link)
Vendor Page Anti WBP4 pAb (ATL-HPA058738)