Anti WBP4 pAb (ATL-HPA058738)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058738-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: WBP4
Alternative Gene Name: FBP21, MGC117310
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022023: 66%, ENSRNOG00000011678: 62%
Entrez Gene ID: 11193
Uniprot ID: O75554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIKQ |
Gene Sequence | SDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIKQ |
Gene ID - Mouse | ENSMUSG00000022023 |
Gene ID - Rat | ENSRNOG00000011678 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti WBP4 pAb (ATL-HPA058738) | |
Datasheet | Anti WBP4 pAb (ATL-HPA058738) Datasheet (External Link) |
Vendor Page | Anti WBP4 pAb (ATL-HPA058738) at Atlas Antibodies |
Documents & Links for Anti WBP4 pAb (ATL-HPA058738) | |
Datasheet | Anti WBP4 pAb (ATL-HPA058738) Datasheet (External Link) |
Vendor Page | Anti WBP4 pAb (ATL-HPA058738) |