Anti WBP2 pAb (ATL-HPA068819)

Atlas Antibodies

Catalog No.:
ATL-HPA068819-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WW domain binding protein 2
Gene Name: WBP2
Alternative Gene Name: WBP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034341: 95%, ENSRNOG00000007971: 93%
Entrez Gene ID: 23558
Uniprot ID: Q969T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYP
Gene Sequence PYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYP
Gene ID - Mouse ENSMUSG00000034341
Gene ID - Rat ENSRNOG00000007971
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WBP2 pAb (ATL-HPA068819)
Datasheet Anti WBP2 pAb (ATL-HPA068819) Datasheet (External Link)
Vendor Page Anti WBP2 pAb (ATL-HPA068819) at Atlas Antibodies

Documents & Links for Anti WBP2 pAb (ATL-HPA068819)
Datasheet Anti WBP2 pAb (ATL-HPA068819) Datasheet (External Link)
Vendor Page Anti WBP2 pAb (ATL-HPA068819)