Anti WBP1 pAb (ATL-HPA057067)

Atlas Antibodies

Catalog No.:
ATL-HPA057067-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WW domain binding protein 1
Gene Name: WBP1
Alternative Gene Name: WBP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030035: 75%, ENSRNOG00000061902: 73%
Entrez Gene ID: 23559
Uniprot ID: Q96G27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEG
Gene Sequence DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEG
Gene ID - Mouse ENSMUSG00000030035
Gene ID - Rat ENSRNOG00000061902
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WBP1 pAb (ATL-HPA057067)
Datasheet Anti WBP1 pAb (ATL-HPA057067) Datasheet (External Link)
Vendor Page Anti WBP1 pAb (ATL-HPA057067) at Atlas Antibodies

Documents & Links for Anti WBP1 pAb (ATL-HPA057067)
Datasheet Anti WBP1 pAb (ATL-HPA057067) Datasheet (External Link)
Vendor Page Anti WBP1 pAb (ATL-HPA057067)