Anti WASL pAb (ATL-HPA005750 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005750-25

Protein Description: Wiskott-Aldrich syndrome-like
Gene Name: WASL
Alternative Gene Name: N-WASP, NWASP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029684: 95%, ENSRNOG00000006975: 95%
Entrez Gene ID: 8976
Uniprot ID: O00401
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS
• Gene Sequence: DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS
• Gene ID - Mouse: ENSMUSG00000029684
• Gene ID - Rat: ENSRNOG00000006975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WASL pAb (ATL-HPA005750 w/enhanced validation) – 9 Found

Goddard, Philippa J; Sanchez-Garrido, Julia; Slater, Sabrina L; Kalyan, Mohini; Ruano-Gallego, David; Marchès, Olivier; Fernández, Luis Ángel; Frankel, Gad; Shenoy, Avinash R. Enteropathogenic Escherichia coli Stimulates Effector-Driven Rapid Caspase-4 Activation in Human Macrophages. Cell Reports. 2019;27(4):1008-1017.e6. 

Pinto, Clyde Savio; Khandekar, Ameya; Bhavna, Rajasekaran; Kiesel, Petra; Pigino, Gaia; Sonawane, Mahendra. Microridges are apical epithelial projections formed of F-actin networks that organize the glycan layer. Scientific Reports. 2019;9(1):12191. 

Yu, Xinzi; Zech, Tobias; McDonald, Laura; Gonzalez, Esther Garcia; Li, Ang; Macpherson, Iain; Schwarz, Juliane P; Spence, Heather; Futó, Kinga; Timpson, Paul; Nixon, Colin; Ma, Yafeng; Anton, Ines M; Visegrády, Balázs; Insall, Robert H; Oien, Karin; Blyth, Karen; Norman, Jim C; Machesky, Laura M. N-WASP coordinates the delivery and F-actin-mediated capture of MT1-MMP at invasive pseudopods. The Journal Of Cell Biology. 2012;199(3):527-44. 

Schell, Christoph; Baumhakl, Lisa; Salou, Sarah; Conzelmann, Ann-Christin; Meyer, Charlotte; Helmstädter, Martin; Wrede, Christoph; Grahammer, Florian; Eimer, Stefan; Kerjaschki, Dontscho; Walz, Gerd; Snapper, Scott; Huber, Tobias B. N-wasp is required for stabilization of podocyte foot processes. Journal Of The American Society Of Nephrology : Jasn. 2013;24(5):713-21. 

Zhao, Miao; Spiess, Matthias; Johansson, Henrik J; Olofsson, Helene; Hu, Jianjiang; Lehtiö, Janne; Strömblad, Staffan. Identification of the PAK4 interactome reveals PAK4 phosphorylation of N-WASP and promotion of Arp2/3-dependent actin polymerization. Oncotarget. 2017;8(44):77061-77074. 

Jiang, Hongbing; Leung, Christian; Tahan, Stephen; Wang, David. Entry by multiple picornaviruses is dependent on a pathway that includes TNK2, WASL, and NCK1. Elife. 2019;8( 31769754) 

Katanov, Christina; Novak, Nurit; Vainshtein, Anya; Golani, Ofra; Dupree, Jeffery L; Peles, Elior. N-Wasp Regulates Oligodendrocyte Myelination. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2020;40(32):6103-6111. 

Whitelaw, Jamie A; Swaminathan, Karthic; Kage, Frieda; Machesky, Laura M. The WAVE Regulatory Complex Is Required to Balance Protrusion and Adhesion in Migration. Cells. 2020;9(7) 

Pătru, Adrian; Şurlin, Valeriu; Mărgăritescu, Claudiu; Ciucă, Eduard Mihai; Matei, Marius; Şerbănescu, Mircea Sebastian; Camen, Adrian. Analysis of the distribution and expression of some tumor invasiveness markers in palate squamous cell carcinomas. Romanian Journal Of Morphology And Embryology = Revue Roumaine De Morphologie Et Embryologie. 2020;61(4):1259-1278.