Anti WASHC5 pAb (ATL-HPA064649)

Atlas Antibodies

Catalog No.: ATL-HPA064649-25

Protein Description: WASH complex subunit 5
Gene Name: WASHC5
Alternative Gene Name: KIAA0196, SPG8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022350: 99%, ENSRNOG00000009739: 100%
Entrez Gene ID: 9897
Uniprot ID: Q12768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRK
• Gene Sequence: ELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRK
• Gene ID - Mouse: ENSMUSG00000022350
• Gene ID - Rat: ENSRNOG00000009739
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.