Anti WASHC5 pAb (ATL-HPA064649)

Atlas Antibodies

Catalog No.:
ATL-HPA064649-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: WASH complex subunit 5
Gene Name: WASHC5
Alternative Gene Name: KIAA0196, SPG8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022350: 99%, ENSRNOG00000009739: 100%
Entrez Gene ID: 9897
Uniprot ID: Q12768
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRK
Gene Sequence ELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDKLRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRK
Gene ID - Mouse ENSMUSG00000022350
Gene ID - Rat ENSRNOG00000009739
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WASHC5 pAb (ATL-HPA064649)
Datasheet Anti WASHC5 pAb (ATL-HPA064649) Datasheet (External Link)
Vendor Page Anti WASHC5 pAb (ATL-HPA064649) at Atlas Antibodies

Documents & Links for Anti WASHC5 pAb (ATL-HPA064649)
Datasheet Anti WASHC5 pAb (ATL-HPA064649) Datasheet (External Link)
Vendor Page Anti WASHC5 pAb (ATL-HPA064649)