Anti WASHC4 pAb (ATL-HPA045666)

Atlas Antibodies

SKU:
ATL-HPA045666-25
  • Immunohistochemical staining of human placenta shows nuclear positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WASH complex subunit 4
Gene Name: WASHC4
Alternative Gene Name: KIAA1033, SWIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034560: 96%, ENSRNOG00000008331: 91%
Entrez Gene ID: 23325
Uniprot ID: Q2M389
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDASMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKII
Gene Sequence KVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDASMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKII
Gene ID - Mouse ENSMUSG00000034560
Gene ID - Rat ENSRNOG00000008331
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WASHC4 pAb (ATL-HPA045666)
Datasheet Anti WASHC4 pAb (ATL-HPA045666) Datasheet (External Link)
Vendor Page Anti WASHC4 pAb (ATL-HPA045666) at Atlas Antibodies

Documents & Links for Anti WASHC4 pAb (ATL-HPA045666)
Datasheet Anti WASHC4 pAb (ATL-HPA045666) Datasheet (External Link)
Vendor Page Anti WASHC4 pAb (ATL-HPA045666)