Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045288-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: WASF2
Alternative Gene Name: SCAR2, WAVE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028868: 92%, ENSRNOG00000009805: 90%
Entrez Gene ID: 10163
Uniprot ID: Q9Y6W5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP |
Gene Sequence | DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP |
Gene ID - Mouse | ENSMUSG00000028868 |
Gene ID - Rat | ENSRNOG00000009805 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) | |
Datasheet | Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) | |
Datasheet | Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) |
Citations for Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) – 1 Found |
Schell, Christoph; Sabass, Benedikt; Helmstaedter, Martin; Geist, Felix; Abed, Ahmed; Yasuda-Yamahara, Mako; Sigle, August; Maier, Jasmin I; Grahammer, Florian; Siegerist, Florian; Artelt, Nadine; Endlich, Nicole; Kerjaschki, Dontscho; Arnold, Hans-Henning; Dengjel, Jörn; Rogg, Manuel; Huber, Tobias B. ARP3 Controls the Podocyte Architecture at the Kidney Filtration Barrier. Developmental Cell. 2018;47(6):741-757.e8. PubMed |