Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045288-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: WAS protein family, member 2
Gene Name: WASF2
Alternative Gene Name: SCAR2, WAVE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028868: 92%, ENSRNOG00000009805: 90%
Entrez Gene ID: 10163
Uniprot ID: Q9Y6W5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP
Gene Sequence DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP
Gene ID - Mouse ENSMUSG00000028868
Gene ID - Rat ENSRNOG00000009805
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation)
Datasheet Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation)
Datasheet Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation)
Citations for Anti WASF2 pAb (ATL-HPA045288 w/enhanced validation) – 1 Found
Schell, Christoph; Sabass, Benedikt; Helmstaedter, Martin; Geist, Felix; Abed, Ahmed; Yasuda-Yamahara, Mako; Sigle, August; Maier, Jasmin I; Grahammer, Florian; Siegerist, Florian; Artelt, Nadine; Endlich, Nicole; Kerjaschki, Dontscho; Arnold, Hans-Henning; Dengjel, Jörn; Rogg, Manuel; Huber, Tobias B. ARP3 Controls the Podocyte Architecture at the Kidney Filtration Barrier. Developmental Cell. 2018;47(6):741-757.e8.  PubMed