Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA069692-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tryptophanyl tRNA synthetase 2, mitochondrial
Gene Name: WARS2
Alternative Gene Name: TrpRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004233: 90%, ENSRNOG00000019508: 88%
Entrez Gene ID: 10352
Uniprot ID: Q9UGM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPA
Gene Sequence MELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPA
Gene ID - Mouse ENSMUSG00000004233
Gene ID - Rat ENSRNOG00000019508
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation)
Datasheet Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation)
Datasheet Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation)