Anti WAPL pAb (ATL-HPA066141)

Atlas Antibodies

Catalog No.:
ATL-HPA066141-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WAPL cohesin release factor
Gene Name: WAPL
Alternative Gene Name: FOE, KIAA0261, WAPAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041408: 81%, ENSRNOG00000052513: 78%
Entrez Gene ID: 23063
Uniprot ID: Q7Z5K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEHEKNSHHIHKNADDSTKKPNAETTVASEIKETNDTWNSQFGKRPESPSEISPIKGSVRTGLFEWDNDFEDIRSEDCILSLDSDPLLEMKDD
Gene Sequence EEHEKNSHHIHKNADDSTKKPNAETTVASEIKETNDTWNSQFGKRPESPSEISPIKGSVRTGLFEWDNDFEDIRSEDCILSLDSDPLLEMKDD
Gene ID - Mouse ENSMUSG00000041408
Gene ID - Rat ENSRNOG00000052513
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WAPL pAb (ATL-HPA066141)
Datasheet Anti WAPL pAb (ATL-HPA066141) Datasheet (External Link)
Vendor Page Anti WAPL pAb (ATL-HPA066141) at Atlas Antibodies

Documents & Links for Anti WAPL pAb (ATL-HPA066141)
Datasheet Anti WAPL pAb (ATL-HPA066141) Datasheet (External Link)
Vendor Page Anti WAPL pAb (ATL-HPA066141)