Anti VWF pAb (ATL-HPA002082)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002082-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: VWF
Alternative Gene Name: F8VWF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001930: 82%, ENSRNOG00000019689: 78%
Entrez Gene ID: 7450
Uniprot ID: P04275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RITLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPKRNSMVLDVAFVL |
Gene Sequence | RITLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPKRNSMVLDVAFVL |
Gene ID - Mouse | ENSMUSG00000001930 |
Gene ID - Rat | ENSRNOG00000019689 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VWF pAb (ATL-HPA002082) | |
Datasheet | Anti VWF pAb (ATL-HPA002082) Datasheet (External Link) |
Vendor Page | Anti VWF pAb (ATL-HPA002082) at Atlas Antibodies |
Documents & Links for Anti VWF pAb (ATL-HPA002082) | |
Datasheet | Anti VWF pAb (ATL-HPA002082) Datasheet (External Link) |
Vendor Page | Anti VWF pAb (ATL-HPA002082) |
Citations for Anti VWF pAb (ATL-HPA002082) – 2 Found |
Chakraborty, Goutam; Kumar, Santosh; Mishra, Rosalin; Patil, Tushar V; Kundu, Gopal C. Semaphorin 3A suppresses tumor growth and metastasis in mice melanoma model. Plos One. 7(3):e33633. PubMed |
Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed |