Anti VWF pAb (ATL-HPA001815)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001815-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: VWF
Alternative Gene Name: F8VWF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001930: 80%, ENSRNOG00000019689: 80%
Entrez Gene ID: 7450
Uniprot ID: P04275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEKT |
Gene Sequence | ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEKT |
Gene ID - Mouse | ENSMUSG00000001930 |
Gene ID - Rat | ENSRNOG00000019689 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VWF pAb (ATL-HPA001815) | |
Datasheet | Anti VWF pAb (ATL-HPA001815) Datasheet (External Link) |
Vendor Page | Anti VWF pAb (ATL-HPA001815) at Atlas Antibodies |
Documents & Links for Anti VWF pAb (ATL-HPA001815) | |
Datasheet | Anti VWF pAb (ATL-HPA001815) Datasheet (External Link) |
Vendor Page | Anti VWF pAb (ATL-HPA001815) |
Citations for Anti VWF pAb (ATL-HPA001815) – 4 Found |
Hao, Feng; Zhang, Fuqiang; Wu, Daniel Dongwei; An, Dong; Shi, Jing; Li, Guohong; Xu, Xuemin; Cui, Mei-Zhen. Lysophosphatidic acid-induced vascular neointimal formation in mouse carotid arteries is mediated by the matricellular protein CCN1/Cyr61. American Journal Of Physiology. Cell Physiology. 2016;311(6):C975-C984. PubMed |
Zhao, Yunyue; Li, Suhua; Quan, Enxi; Zhang, Hui; Wu, Yongxiang; Luo, Yanting; Peng, Long; Wang, Jiarui; Zhu, Jieming; Liu, Jinlai. Trimetazidine inhibits cardiac fibrosis by reducing reactive oxygen species and downregulating connective tissue growth factor in streptozotocin-induced diabetic rats. Experimental And Therapeutic Medicine. 2019;18(2):1477-1485. PubMed |
Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed |
LaBonty, Melissa; Pray, Nicholas; Yelick, Pamela C. Injury of Adult Zebrafish Expressing Acvr1l(Q204D) Does Not Result in Heterotopic Ossification. Zebrafish. 2018;15(6):536-545. PubMed |