Anti VWDE pAb (ATL-HPA026619)

Atlas Antibodies

Catalog No.: ATL-HPA026619-25

Protein Description: von Willebrand factor D and EGF domains
Gene Name: VWDE
Alternative Gene Name: FLJ14712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079679: 90%, ENSRNOG00000024709: 87%
Entrez Gene ID: 221806
Uniprot ID: Q8N2E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YRSVRFDSWHLQQSAVQDLICDHSLSPGWYRFLILDRPAEMPTKCVEMNHCGTQAPIWLSLRDSETLPSPGEIKQLTACATWQFLFSTTKDCCLFQIPVSVRNCGNFFVYLLQPTQGCMGYCA
• Gene Sequence: YRSVRFDSWHLQQSAVQDLICDHSLSPGWYRFLILDRPAEMPTKCVEMNHCGTQAPIWLSLRDSETLPSPGEIKQLTACATWQFLFSTTKDCCLFQIPVSVRNCGNFFVYLLQPTQGCMGYCA
• Gene ID - Mouse: ENSMUSG00000079679
• Gene ID - Rat: ENSRNOG00000024709
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.