Anti VWC2L pAb (ATL-HPA059414)

Atlas Antibodies

Catalog No.: ATL-HPA059414-25

Protein Description: von Willebrand factor C domain containing protein 2-like
Gene Name: VWC2L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045648: 100%, ENSRNOG00000049076: 57%
Entrez Gene ID: 402117
Uniprot ID: B2RUY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFVYKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPE
• Gene Sequence: GFVYKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPE
• Gene ID - Mouse: ENSMUSG00000045648
• Gene ID - Rat: ENSRNOG00000049076
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.