Anti VWC2L pAb (ATL-HPA044815)

Atlas Antibodies

Catalog No.:
ATL-HPA044815-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: von Willebrand factor C domain containing protein 2-like
Gene Name: VWC2L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045648: 97%, ENSRNOG00000027400: 40%
Entrez Gene ID: 402117
Uniprot ID: B2RUY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAISHEDYPADEGDQISSNDNLIFDDYRGK
Gene Sequence AAISHEDYPADEGDQISSNDNLIFDDYRGK
Gene ID - Mouse ENSMUSG00000045648
Gene ID - Rat ENSRNOG00000027400
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VWC2L pAb (ATL-HPA044815)
Datasheet Anti VWC2L pAb (ATL-HPA044815) Datasheet (External Link)
Vendor Page Anti VWC2L pAb (ATL-HPA044815) at Atlas Antibodies

Documents & Links for Anti VWC2L pAb (ATL-HPA044815)
Datasheet Anti VWC2L pAb (ATL-HPA044815) Datasheet (External Link)
Vendor Page Anti VWC2L pAb (ATL-HPA044815)