Anti VWA5B2 pAb (ATL-HPA061412)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061412-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: VWA5B2
Alternative Gene Name: DKFZp761K032, LOC90113
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046613: 53%, ENSRNOG00000001707: 52%
Entrez Gene ID: 90113
Uniprot ID: Q8N398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGPRRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYL |
Gene Sequence | LPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGPRRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYL |
Gene ID - Mouse | ENSMUSG00000046613 |
Gene ID - Rat | ENSRNOG00000001707 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VWA5B2 pAb (ATL-HPA061412) | |
Datasheet | Anti VWA5B2 pAb (ATL-HPA061412) Datasheet (External Link) |
Vendor Page | Anti VWA5B2 pAb (ATL-HPA061412) at Atlas Antibodies |
Documents & Links for Anti VWA5B2 pAb (ATL-HPA061412) | |
Datasheet | Anti VWA5B2 pAb (ATL-HPA061412) Datasheet (External Link) |
Vendor Page | Anti VWA5B2 pAb (ATL-HPA061412) |