Anti VWA5B2 pAb (ATL-HPA061412)

Atlas Antibodies

Catalog No.:
ATL-HPA061412-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: von Willebrand factor A domain containing 5B2
Gene Name: VWA5B2
Alternative Gene Name: DKFZp761K032, LOC90113
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046613: 53%, ENSRNOG00000001707: 52%
Entrez Gene ID: 90113
Uniprot ID: Q8N398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGPRRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYL
Gene Sequence LPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGPRRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYL
Gene ID - Mouse ENSMUSG00000046613
Gene ID - Rat ENSRNOG00000001707
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VWA5B2 pAb (ATL-HPA061412)
Datasheet Anti VWA5B2 pAb (ATL-HPA061412) Datasheet (External Link)
Vendor Page Anti VWA5B2 pAb (ATL-HPA061412) at Atlas Antibodies

Documents & Links for Anti VWA5B2 pAb (ATL-HPA061412)
Datasheet Anti VWA5B2 pAb (ATL-HPA061412) Datasheet (External Link)
Vendor Page Anti VWA5B2 pAb (ATL-HPA061412)