Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA064829-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: von Willebrand factor A domain containing 5B1
Gene Name: VWA5B1
Alternative Gene Name: FLJ32784
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028753: 62%, ENSRNOG00000016553: 57%
Entrez Gene ID: 127731
Uniprot ID: Q5TIE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CNIISKYTAFVPVDVSKSRYLPTVVEYPNSGAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGN
Gene Sequence CNIISKYTAFVPVDVSKSRYLPTVVEYPNSGAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGN
Gene ID - Mouse ENSMUSG00000028753
Gene ID - Rat ENSRNOG00000016553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation)
Datasheet Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation)
Datasheet Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation)