Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA064829-25

Protein Description: von Willebrand factor A domain containing 5B1
Gene Name: VWA5B1
Alternative Gene Name: FLJ32784
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028753: 62%, ENSRNOG00000016553: 57%
Entrez Gene ID: 127731
Uniprot ID: Q5TIE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CNIISKYTAFVPVDVSKSRYLPTVVEYPNSGAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGN
• Gene Sequence: CNIISKYTAFVPVDVSKSRYLPTVVEYPNSGAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGN
• Gene ID - Mouse: ENSMUSG00000028753
• Gene ID - Rat: ENSRNOG00000016553
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.