Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA064829-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: VWA5B1
Alternative Gene Name: FLJ32784
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028753: 62%, ENSRNOG00000016553: 57%
Entrez Gene ID: 127731
Uniprot ID: Q5TIE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CNIISKYTAFVPVDVSKSRYLPTVVEYPNSGAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGN |
Gene Sequence | CNIISKYTAFVPVDVSKSRYLPTVVEYPNSGAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGN |
Gene ID - Mouse | ENSMUSG00000028753 |
Gene ID - Rat | ENSRNOG00000016553 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) | |
Datasheet | Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) | |
Datasheet | Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) |