Anti VTN pAb (ATL-HPA068011)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068011-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: VTN
Alternative Gene Name: VN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017344: 93%, ENSRNOG00000010031: 95%
Entrez Gene ID: 7448
Uniprot ID: P04004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR |
| Gene Sequence | SLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGR |
| Gene ID - Mouse | ENSMUSG00000017344 |
| Gene ID - Rat | ENSRNOG00000010031 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VTN pAb (ATL-HPA068011) | |
| Datasheet | Anti VTN pAb (ATL-HPA068011) Datasheet (External Link) |
| Vendor Page | Anti VTN pAb (ATL-HPA068011) at Atlas Antibodies |
| Documents & Links for Anti VTN pAb (ATL-HPA068011) | |
| Datasheet | Anti VTN pAb (ATL-HPA068011) Datasheet (External Link) |
| Vendor Page | Anti VTN pAb (ATL-HPA068011) |