Anti VTN pAb (ATL-HPA060933)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060933-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: VTN
Alternative Gene Name: VN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017344: 58%, ENSRNOG00000010031: 58%
Entrez Gene ID: 7448
Uniprot ID: P04004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPE |
Gene Sequence | KCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPE |
Gene ID - Mouse | ENSMUSG00000017344 |
Gene ID - Rat | ENSRNOG00000010031 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VTN pAb (ATL-HPA060933) | |
Datasheet | Anti VTN pAb (ATL-HPA060933) Datasheet (External Link) |
Vendor Page | Anti VTN pAb (ATL-HPA060933) at Atlas Antibodies |
Documents & Links for Anti VTN pAb (ATL-HPA060933) | |
Datasheet | Anti VTN pAb (ATL-HPA060933) Datasheet (External Link) |
Vendor Page | Anti VTN pAb (ATL-HPA060933) |