Anti VTI1A pAb (ATL-HPA054108)

Atlas Antibodies

Catalog No.:
ATL-HPA054108-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: vesicle transport through interaction with t-SNAREs 1A
Gene Name: VTI1A
Alternative Gene Name: MVti1, Vti1-rp2, Vti1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024983: 76%, ENSRNOG00000042786: 80%
Entrez Gene ID: 143187
Uniprot ID: Q96AJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRGCSVKKQCNLSLAPK
Gene Sequence SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRGCSVKKQCNLSLAPK
Gene ID - Mouse ENSMUSG00000024983
Gene ID - Rat ENSRNOG00000042786
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VTI1A pAb (ATL-HPA054108)
Datasheet Anti VTI1A pAb (ATL-HPA054108) Datasheet (External Link)
Vendor Page Anti VTI1A pAb (ATL-HPA054108) at Atlas Antibodies

Documents & Links for Anti VTI1A pAb (ATL-HPA054108)
Datasheet Anti VTI1A pAb (ATL-HPA054108) Datasheet (External Link)
Vendor Page Anti VTI1A pAb (ATL-HPA054108)