Anti VSTM5 pAb (ATL-HPA063591)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063591-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: VSTM5
Alternative Gene Name: C11orf90, LOC387804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031937: 83%, ENSRNOG00000010480: 83%
Entrez Gene ID: 387804
Uniprot ID: A8MXK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NKCAYKFQRKRRHKLKESTTEEIELEDVEC |
| Gene Sequence | NKCAYKFQRKRRHKLKESTTEEIELEDVEC |
| Gene ID - Mouse | ENSMUSG00000031937 |
| Gene ID - Rat | ENSRNOG00000010480 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VSTM5 pAb (ATL-HPA063591) | |
| Datasheet | Anti VSTM5 pAb (ATL-HPA063591) Datasheet (External Link) |
| Vendor Page | Anti VSTM5 pAb (ATL-HPA063591) at Atlas Antibodies |
| Documents & Links for Anti VSTM5 pAb (ATL-HPA063591) | |
| Datasheet | Anti VSTM5 pAb (ATL-HPA063591) Datasheet (External Link) |
| Vendor Page | Anti VSTM5 pAb (ATL-HPA063591) |