Anti VSTM5 pAb (ATL-HPA063591)

Atlas Antibodies

Catalog No.: ATL-HPA063591-25

Protein Description: V-set and transmembrane domain containing 5
Gene Name: VSTM5
Alternative Gene Name: C11orf90, LOC387804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031937: 83%, ENSRNOG00000010480: 83%
Entrez Gene ID: 387804
Uniprot ID: A8MXK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKCAYKFQRKRRHKLKESTTEEIELEDVEC
• Gene Sequence: NKCAYKFQRKRRHKLKESTTEEIELEDVEC
• Gene ID - Mouse: ENSMUSG00000031937
• Gene ID - Rat: ENSRNOG00000010480
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.