Anti VSTM5 pAb (ATL-HPA063591)

Atlas Antibodies

Catalog No.:
ATL-HPA063591-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: V-set and transmembrane domain containing 5
Gene Name: VSTM5
Alternative Gene Name: C11orf90, LOC387804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031937: 83%, ENSRNOG00000010480: 83%
Entrez Gene ID: 387804
Uniprot ID: A8MXK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKCAYKFQRKRRHKLKESTTEEIELEDVEC
Gene Sequence NKCAYKFQRKRRHKLKESTTEEIELEDVEC
Gene ID - Mouse ENSMUSG00000031937
Gene ID - Rat ENSRNOG00000010480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VSTM5 pAb (ATL-HPA063591)
Datasheet Anti VSTM5 pAb (ATL-HPA063591) Datasheet (External Link)
Vendor Page Anti VSTM5 pAb (ATL-HPA063591) at Atlas Antibodies

Documents & Links for Anti VSTM5 pAb (ATL-HPA063591)
Datasheet Anti VSTM5 pAb (ATL-HPA063591) Datasheet (External Link)
Vendor Page Anti VSTM5 pAb (ATL-HPA063591)