Anti VSTM4 pAb (ATL-HPA017279)

Atlas Antibodies

Catalog No.:
ATL-HPA017279-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: V-set and transmembrane domain containing 4
Gene Name: VSTM4
Alternative Gene Name: C10orf72, FLJ31737
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050666: 92%, ENSRNOG00000020078: 90%
Entrez Gene ID: 196740
Uniprot ID: Q8IW00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVRHYLVKCPQNSSGETVTSVTSLAPLQPKKGKRQKEKPDIPPAVPAKAPIAPTFHKPKLLKPQRKVTLPKIAEENLTYAELELIKPHRAAKGAPTSTVYAQILFE
Gene Sequence RVRHYLVKCPQNSSGETVTSVTSLAPLQPKKGKRQKEKPDIPPAVPAKAPIAPTFHKPKLLKPQRKVTLPKIAEENLTYAELELIKPHRAAKGAPTSTVYAQILFE
Gene ID - Mouse ENSMUSG00000050666
Gene ID - Rat ENSRNOG00000020078
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VSTM4 pAb (ATL-HPA017279)
Datasheet Anti VSTM4 pAb (ATL-HPA017279) Datasheet (External Link)
Vendor Page Anti VSTM4 pAb (ATL-HPA017279) at Atlas Antibodies

Documents & Links for Anti VSTM4 pAb (ATL-HPA017279)
Datasheet Anti VSTM4 pAb (ATL-HPA017279) Datasheet (External Link)
Vendor Page Anti VSTM4 pAb (ATL-HPA017279)