Anti VSIG10L pAb (ATL-HPA060453)

Atlas Antibodies

Catalog No.: ATL-HPA060453-25

Protein Description: V-set and immunoglobulin domain containing 10 like
Gene Name: VSIG10L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070604: 77%, ENSRNOG00000023411: 78%
Entrez Gene ID: 147645
Uniprot ID: Q86VR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLTWDVERGALISSFEIQAWPDGPALGRTSTYRDWVSLLILGPQERSAVVPLPPRNPGTWTFRILPILGGQPGTPSQSRVY
• Gene Sequence: VLTWDVERGALISSFEIQAWPDGPALGRTSTYRDWVSLLILGPQERSAVVPLPPRNPGTWTFRILPILGGQPGTPSQSRVY
• Gene ID - Mouse: ENSMUSG00000070604
• Gene ID - Rat: ENSRNOG00000023411
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.