Anti VSIG10 pAb (ATL-HPA062022)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062022-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: VSIG10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066894: 72%, ENSRNOG00000022698: 74%
Entrez Gene ID: 54621
Uniprot ID: Q8N0Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK |
Gene Sequence | LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK |
Gene ID - Mouse | ENSMUSG00000066894 |
Gene ID - Rat | ENSRNOG00000022698 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VSIG10 pAb (ATL-HPA062022) | |
Datasheet | Anti VSIG10 pAb (ATL-HPA062022) Datasheet (External Link) |
Vendor Page | Anti VSIG10 pAb (ATL-HPA062022) at Atlas Antibodies |
Documents & Links for Anti VSIG10 pAb (ATL-HPA062022) | |
Datasheet | Anti VSIG10 pAb (ATL-HPA062022) Datasheet (External Link) |
Vendor Page | Anti VSIG10 pAb (ATL-HPA062022) |