Anti VSIG10 pAb (ATL-HPA062022)

Atlas Antibodies

Catalog No.:
ATL-HPA062022-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: V-set and immunoglobulin domain containing 10
Gene Name: VSIG10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066894: 72%, ENSRNOG00000022698: 74%
Entrez Gene ID: 54621
Uniprot ID: Q8N0Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK
Gene Sequence LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK
Gene ID - Mouse ENSMUSG00000066894
Gene ID - Rat ENSRNOG00000022698
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VSIG10 pAb (ATL-HPA062022)
Datasheet Anti VSIG10 pAb (ATL-HPA062022) Datasheet (External Link)
Vendor Page Anti VSIG10 pAb (ATL-HPA062022) at Atlas Antibodies

Documents & Links for Anti VSIG10 pAb (ATL-HPA062022)
Datasheet Anti VSIG10 pAb (ATL-HPA062022) Datasheet (External Link)
Vendor Page Anti VSIG10 pAb (ATL-HPA062022)