Anti VPS72 pAb (ATL-HPA065709)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065709-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: VPS72
Alternative Gene Name: Swc2, TCFL1, YL-1, YL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008958: 100%, ENSRNOG00000021081: 100%
Entrez Gene ID: 6944
Uniprot ID: Q15906
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE |
Gene Sequence | RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE |
Gene ID - Mouse | ENSMUSG00000008958 |
Gene ID - Rat | ENSRNOG00000021081 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VPS72 pAb (ATL-HPA065709) | |
Datasheet | Anti VPS72 pAb (ATL-HPA065709) Datasheet (External Link) |
Vendor Page | Anti VPS72 pAb (ATL-HPA065709) at Atlas Antibodies |
Documents & Links for Anti VPS72 pAb (ATL-HPA065709) | |
Datasheet | Anti VPS72 pAb (ATL-HPA065709) Datasheet (External Link) |
Vendor Page | Anti VPS72 pAb (ATL-HPA065709) |