Anti VPS72 pAb (ATL-HPA065709)

Atlas Antibodies

Catalog No.:
ATL-HPA065709-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 72 homolog (S. cerevisiae)
Gene Name: VPS72
Alternative Gene Name: Swc2, TCFL1, YL-1, YL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008958: 100%, ENSRNOG00000021081: 100%
Entrez Gene ID: 6944
Uniprot ID: Q15906
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE
Gene Sequence RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE
Gene ID - Mouse ENSMUSG00000008958
Gene ID - Rat ENSRNOG00000021081
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS72 pAb (ATL-HPA065709)
Datasheet Anti VPS72 pAb (ATL-HPA065709) Datasheet (External Link)
Vendor Page Anti VPS72 pAb (ATL-HPA065709) at Atlas Antibodies

Documents & Links for Anti VPS72 pAb (ATL-HPA065709)
Datasheet Anti VPS72 pAb (ATL-HPA065709) Datasheet (External Link)
Vendor Page Anti VPS72 pAb (ATL-HPA065709)