Anti VPS54 pAb (ATL-HPA070582)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070582-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: VPS54
Alternative Gene Name: HCC8, PPP1R164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020128: 92%, ENSRNOG00000007125: 81%
Entrez Gene ID: 51542
Uniprot ID: Q9P1Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IRPVPSLPDVCPKEPTGDSHSLYVAPSLVTDQHRWTVYHSKVNLPAALNDPRLAKRESDFFTKTWGLDFVDTEVIPSFYLPQISKEHFTVYQQEIS |
Gene Sequence | IRPVPSLPDVCPKEPTGDSHSLYVAPSLVTDQHRWTVYHSKVNLPAALNDPRLAKRESDFFTKTWGLDFVDTEVIPSFYLPQISKEHFTVYQQEIS |
Gene ID - Mouse | ENSMUSG00000020128 |
Gene ID - Rat | ENSRNOG00000007125 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VPS54 pAb (ATL-HPA070582) | |
Datasheet | Anti VPS54 pAb (ATL-HPA070582) Datasheet (External Link) |
Vendor Page | Anti VPS54 pAb (ATL-HPA070582) at Atlas Antibodies |
Documents & Links for Anti VPS54 pAb (ATL-HPA070582) | |
Datasheet | Anti VPS54 pAb (ATL-HPA070582) Datasheet (External Link) |
Vendor Page | Anti VPS54 pAb (ATL-HPA070582) |