Anti VPS54 pAb (ATL-HPA067981)

Atlas Antibodies

Catalog No.:
ATL-HPA067981-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 54 homolog (S. cerevisiae)
Gene Name: VPS54
Alternative Gene Name: HCC8, PPP1R164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020128: 97%, ENSRNOG00000007125: 98%
Entrez Gene ID: 51542
Uniprot ID: Q9P1Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKIHERCKNICPPKDTFERTLLHTHDKSRTDLEQVPKIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVN
Gene Sequence EKIHERCKNICPPKDTFERTLLHTHDKSRTDLEQVPKIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVN
Gene ID - Mouse ENSMUSG00000020128
Gene ID - Rat ENSRNOG00000007125
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS54 pAb (ATL-HPA067981)
Datasheet Anti VPS54 pAb (ATL-HPA067981) Datasheet (External Link)
Vendor Page Anti VPS54 pAb (ATL-HPA067981) at Atlas Antibodies

Documents & Links for Anti VPS54 pAb (ATL-HPA067981)
Datasheet Anti VPS54 pAb (ATL-HPA067981) Datasheet (External Link)
Vendor Page Anti VPS54 pAb (ATL-HPA067981)