Anti VPS53 pAb (ATL-HPA024446 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024446-25

Protein Description: vacuolar protein sorting 53 homolog (S. cerevisiae)
Gene Name: VPS53
Alternative Gene Name: FLJ10979, HCCS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017288: 92%, ENSRNOG00000006895: 94%
Entrez Gene ID: 55275
Uniprot ID: Q5VIR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIK
• Gene Sequence: ETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIK
• Gene ID - Mouse: ENSMUSG00000017288
• Gene ID - Rat: ENSRNOG00000006895
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VPS53 pAb (ATL-HPA024446 w/enhanced validation) – 4 Found

Hunter, Morag R; Hesketh, Geoffrey G; Benedyk, Tomasz H; Gingras, Anne-Claude; Graham, Stephen C. Proteomic and Biochemical Comparison of the Cellular Interaction Partners of Human VPS33A and VPS33B. Journal Of Molecular Biology. 2018;430(14):2153-2163. 

Gershlick, David C; Schindler, Christina; Chen, Yu; Bonifacino, Juan S. TSSC1 is novel component of the endosomal retrieval machinery. Molecular Biology Of The Cell. 2016;27(18):2867-78. 

Gershlick, David C; Ishida, Morié; Jones, Julie R; Bellomo, Allison; Bonifacino, Juan S; Everman, David B. A neurodevelopmental disorder caused by mutations in the VPS51 subunit of the GARP and EARP complexes. Human Molecular Genetics. 2019;28(9):1548-1560. 

Ishida, Morié; Bonifacino, Juan S. ARFRP1 functions upstream of ARL1 and ARL5 to coordinate recruitment of distinct tethering factors to the trans-Golgi network. The Journal Of Cell Biology. 2019;218(11):3681-3696.