Anti VPS53 pAb (ATL-HPA022988)

Atlas Antibodies

Catalog No.: ATL-HPA022988-25

Protein Description: vacuolar protein sorting 53 homolog (S. cerevisiae)
Gene Name: VPS53
Alternative Gene Name: FLJ10979, HCCS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017288: 95%, ENSRNOG00000006895: 94%
Entrez Gene ID: 55275
Uniprot ID: Q5VIR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAWLDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELAKIMRTRAKEIEVKLL
• Gene Sequence: LRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAWLDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELAKIMRTRAKEIEVKLL
• Gene ID - Mouse: ENSMUSG00000017288
• Gene ID - Rat: ENSRNOG00000006895
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.