Anti VPS53 pAb (ATL-HPA022988)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022988-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: VPS53
Alternative Gene Name: FLJ10979, HCCS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017288: 95%, ENSRNOG00000006895: 94%
Entrez Gene ID: 55275
Uniprot ID: Q5VIR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAWLDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELAKIMRTRAKEIEVKLL |
| Gene Sequence | LRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAWLDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELAKIMRTRAKEIEVKLL |
| Gene ID - Mouse | ENSMUSG00000017288 |
| Gene ID - Rat | ENSRNOG00000006895 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VPS53 pAb (ATL-HPA022988) | |
| Datasheet | Anti VPS53 pAb (ATL-HPA022988) Datasheet (External Link) |
| Vendor Page | Anti VPS53 pAb (ATL-HPA022988) at Atlas Antibodies |
| Documents & Links for Anti VPS53 pAb (ATL-HPA022988) | |
| Datasheet | Anti VPS53 pAb (ATL-HPA022988) Datasheet (External Link) |
| Vendor Page | Anti VPS53 pAb (ATL-HPA022988) |