Anti VPS51 pAb (ATL-HPA061447)

Atlas Antibodies

Catalog No.:
ATL-HPA061447-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 51 homolog (S. cerevisiae)
Gene Name: VPS51
Alternative Gene Name: ANG2, ANG3, C11orf2, C11orf3, FFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024797: 93%, ENSRNOG00000020996: 93%
Entrez Gene ID: 738
Uniprot ID: Q9UID3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPPAPDVLEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAGAEKLAAFARQLGSRYFALVERRLAQEQGGGDNSLLVRALDRFH
Gene Sequence SPPAPDVLEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAGAEKLAAFARQLGSRYFALVERRLAQEQGGGDNSLLVRALDRFH
Gene ID - Mouse ENSMUSG00000024797
Gene ID - Rat ENSRNOG00000020996
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS51 pAb (ATL-HPA061447)
Datasheet Anti VPS51 pAb (ATL-HPA061447) Datasheet (External Link)
Vendor Page Anti VPS51 pAb (ATL-HPA061447) at Atlas Antibodies

Documents & Links for Anti VPS51 pAb (ATL-HPA061447)
Datasheet Anti VPS51 pAb (ATL-HPA061447) Datasheet (External Link)
Vendor Page Anti VPS51 pAb (ATL-HPA061447)
Citations for Anti VPS51 pAb (ATL-HPA061447) – 2 Found
Koike, Seiichi; Jahn, Reinhard. SNAREs define targeting specificity of trafficking vesicles by combinatorial interaction with tethering factors. Nature Communications. 2019;10(1):1608.  PubMed
Topalidou, Irini; Cattin-Ortolá, Jérôme; Hummer, Blake; Asensio, Cedric S; Ailion, Michael. EIPR1 controls dense-core vesicle cargo retention and EARP complex localization in insulin-secreting cells. Molecular Biology Of The Cell. 2020;31(1):59-79.  PubMed