Anti VPS51 pAb (ATL-HPA061447)

Atlas Antibodies

Catalog No.: ATL-HPA061447-25

Protein Description: vacuolar protein sorting 51 homolog (S. cerevisiae)
Gene Name: VPS51
Alternative Gene Name: ANG2, ANG3, C11orf2, C11orf3, FFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024797: 93%, ENSRNOG00000020996: 93%
Entrez Gene ID: 738
Uniprot ID: Q9UID3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPPAPDVLEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAGAEKLAAFARQLGSRYFALVERRLAQEQGGGDNSLLVRALDRFH
• Gene Sequence: SPPAPDVLEFTDHGGSGFVGGLCQVAAAYQELFAAQGPAGAEKLAAFARQLGSRYFALVERRLAQEQGGGDNSLLVRALDRFH
• Gene ID - Mouse: ENSMUSG00000024797
• Gene ID - Rat: ENSRNOG00000020996
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VPS51 pAb (ATL-HPA061447) – 2 Found

Koike, Seiichi; Jahn, Reinhard. SNAREs define targeting specificity of trafficking vesicles by combinatorial interaction with tethering factors. Nature Communications. 2019;10(1):1608. 

Topalidou, Irini; Cattin-Ortolá, Jérôme; Hummer, Blake; Asensio, Cedric S; Ailion, Michael. EIPR1 controls dense-core vesicle cargo retention and EARP complex localization in insulin-secreting cells. Molecular Biology Of The Cell. 2020;31(1):59-79.