Anti VPS45 pAb (ATL-HPA027425)

Atlas Antibodies

Catalog No.:
ATL-HPA027425-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 45 homolog (S. cerevisiae)
Gene Name: VPS45
Alternative Gene Name: h-vps45, H1, VPS45A, VPS45B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015747: 97%, ENSRNOG00000021173: 97%
Entrez Gene ID: 11311
Uniprot ID: Q9NRW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KETTGIVSMVYTQSEILQKEVYLFERIDSQNREIMKHLKAICFLRPTKENVDYIIQELRRPKYTIYFIYFSNVISKSDVKSLAEADEQEVVA
Gene Sequence KETTGIVSMVYTQSEILQKEVYLFERIDSQNREIMKHLKAICFLRPTKENVDYIIQELRRPKYTIYFIYFSNVISKSDVKSLAEADEQEVVA
Gene ID - Mouse ENSMUSG00000015747
Gene ID - Rat ENSRNOG00000021173
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS45 pAb (ATL-HPA027425)
Datasheet Anti VPS45 pAb (ATL-HPA027425) Datasheet (External Link)
Vendor Page Anti VPS45 pAb (ATL-HPA027425) at Atlas Antibodies

Documents & Links for Anti VPS45 pAb (ATL-HPA027425)
Datasheet Anti VPS45 pAb (ATL-HPA027425) Datasheet (External Link)
Vendor Page Anti VPS45 pAb (ATL-HPA027425)