Anti VPS41 pAb (ATL-HPA020080 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA020080-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 41 homolog (S. cerevisiae)
Gene Name: VPS41
Alternative Gene Name: HVSP41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041236: 97%, ENSRNOG00000012940: 32%
Entrez Gene ID: 27072
Uniprot ID: P49754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEM
Gene Sequence DPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEM
Gene ID - Mouse ENSMUSG00000041236
Gene ID - Rat ENSRNOG00000012940
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS41 pAb (ATL-HPA020080 w/enhanced validation)
Datasheet Anti VPS41 pAb (ATL-HPA020080 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VPS41 pAb (ATL-HPA020080 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti VPS41 pAb (ATL-HPA020080 w/enhanced validation)
Datasheet Anti VPS41 pAb (ATL-HPA020080 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VPS41 pAb (ATL-HPA020080 w/enhanced validation)